SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026417 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026417
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.33e-55
Family Extradiol dioxygenases 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026417   Gene: ENSMMUG00000020078   Transcript: ENSMMUT00000028234
Sequence length 381
Comment pep:known chromosome:MMUL_1:1:48240432:48242205:1 gene:ENSMMUG00000020078 transcript:ENSMMUT00000028234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALRLCHIAFHVPAGQPLARDLQHLFGFQPLASREVDGWRQLALRSGDAVFLVNEGP
GSGEPLYGLDPRHAVPSATNLCFDVADVGAATRELAALGCSVPVPPVRVRDTQGAATYAV
VSSPAGNISLTLLERAGYRGPFLPGFRPVPSAPGPGWVSRVDHLTLACTAGSSPTLLRWF
HNCLGFCHLPLSPDEDPELGLEITAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTR
QDQVEQFLARHKGPGLQHVGLYTPNIVEATERVAAAGGQFLAPPGAYYQQPGKERQIRAA
GHEPHLLARQGILLDGDEGKFLLQVFTKSLFTEDTFFLELIQRQGATGFGQGNIRALWQS
VQEQAAKSQEAEGCPELSAAS
Download sequence
Identical sequences ENSMMUP00000026417 XP_001100445.1.72884 9544.ENSMMUP00000026417 ENSMMUP00000026417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]