SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026542 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026542
Domain Number 1 Region: 283-581
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 1.57e-113
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.000000192
Further Details:      
 
Domain Number 2 Region: 10-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.59e-72
Family G proteins 0.000000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026542   Gene: ENSMMUG00000020157   Transcript: ENSMMUT00000028362
Sequence length 633
Comment pep:known chromosome:MMUL_1:1:92082241:92097383:1 gene:ENSMMUG00000020157 transcript:ENSMMUT00000028362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGPKMLAPICLVENNNDKLLVNQQAIQILEKISQPVVVVAIVGLYRTGKSYLMNHLAG
QNHGFPLGSTVQSETKGIWMWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAV
LLCSTFVYNSMSTINHQALEQLHYVTELTELIKAKSNPRPDGVEDSTEFVSFFPDFIWTV
RDFTLELKLNGDPITEDEYLENALKLIQGKNPKVQTSNLPRECIRHFFPKRKCFVFDRPT
HDKDLLANIEKVAEKQLDPKFQEQTNIFCSYIFTHARTKTLREGITVTGNRLGTLAVTYV
DAINSGAVPCLENAVITLAQRENSAAMQRAADHYSQQMAQRVKLPTDTLQDLLDVHAACE
REAIAVFMEHSFKDENQEFQKKLVEITMNKKGEFLLQNEESSVQYCQAKLNELSKGLMES
ISAGSFSVPGGHKLYMETKEKIEQDYWQVPRKGVKAKEVFQRFLESQVVIEKSILQSDKV
LTDREKAVAVDQAKKEAAEKEQELLKQKLQEQQQQMEAQEKSLKENIAQLKEKLQMEREH
LLREQNMMLEHKLKVQKDLLDEGFKKKSEEMNAEINQLKHVIDTTKNDDTPWIARTLDKL
GDELTSILSAPAKLIGQVVKGVSSLFKKHKLLF
Download sequence
Identical sequences 9544.ENSMMUP00000026542 ENSMMUP00000026542 XP_015000042.1.72884 ENSMMUP00000026542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]