SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026750 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026750
Domain Number 1 Region: 1042-1228
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.03e-18
Family Haloperoxidase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026750   Gene: ENSMMUG00000020326   Transcript: ENSMMUT00000028590
Sequence length 1308
Comment pep:known chromosome:MMUL_1:8:140615004:140742110:-1 gene:ENSMMUG00000020326 transcript:ENSMMUT00000028590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDALSEVDFQLKVDLHFTDSEQQLRDVAGAPMVSSRTLGLHFHPRNGLHHQVPVMFDYF
HLSVISVTVHAALVALQQPLISFTRPGRGSWLGKGGPDTGQEQSIISLENLVFGAGYCKP
TSSEGSFYITSENCMQHAHKWHRDLCLLLLHAYRGLRLHFLVIMRDIPELPHTELEALAV
EETLSQLCSELQMLNNPEKIAEQISKDLAWLTSHMMALWTQFLDTVTLHSQVTTYLTQEH
HTLRVRRFSEAFFYMEHQKLAVLTFQENLIQTHSQLSLDIRNSEYLTSMPPLPAECLDID
GDWNTLPVIFEDRYVDCPATGHNLSVYPNFDVPVTSPTIMNLKEKADNCMVNGNLSFRED
LVLSTIKPSQMDSDEEVIKCPELAENVATQKHMDVCSESQVYITIGEFQNKTGVPEDECW
TGQTSDAGTHPMADVDTSRRSPGPEDGQAPVLTYIDVKSSNKNPSRAEPLVAFNAQHENR
SSRDKYGLDGTGPSKVVVGGSHQNAISSDKTTLHELSTLGKGIDQEGKMVLLSLKLTPSE
PCDPLNSTVREPLDIRSSLKDSHTEEQEELSVLSGVIKRSASIISDSGIESEPSSVAWSE
ARSRALELPSDREVLHPFVRRHALHRNSLEGGHTESNTSLPSGIQASLTSISSLPFEEDE
REVALTKLTKSVSAPHISSPEEAAEDADTKQQGGSFAEPSDMHSKSQGSPGPCSQLSGDS
GTQDAGADHPLVEIVLDADNQQGPGYIDIPKGKGKQFDAQGHCLPDGRTENTPGVETKGL
NLKIPRVIALENPRTRSLPRALVETPKGIPKDLNVGQPALSNSGISEVEGLSQHQVPELS
YTSAADAINMNSTGQQSQSGSPCIMDDTAFNRGVNAFPEAKHKAGTVCPTVTHSVHSQVL
KNQELKAGTSIMGSHLTSAETFTLDSLKAVEVVNLSVSCTATCLPFSSVPKETPARAGFS
SKQTLFPITHQPLGSFGVVSTHSSTLDEEVSERMFSFYQAKEKFKKELKIEGFLYSDLTV
LASDIPYFPPEEEEENLEDGIHLVVCVHGLDGNSADLRLVKTFIELGLPGGKLDFLMSEK
NQMDTFADFDTMTDRLLDEIIQHIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLN
KLHTFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQ
KTGLQYFKNVVLVASPQDRYVPFHSARIEMCKTALKDRHTGPVYAEMINNLLGPLVEAKD
CTLIRHNVFHALPNTANTLIGRAAHIAVLDSELFLEKFFLVAGLNYFK
Download sequence
Identical sequences 9544.ENSMMUP00000026750 XP_015001530.1.72884 XP_015310709.1.63531 ENSMMUP00000026750 ENSMMUP00000026750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]