SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026761 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026761
Domain Number 1 Region: 241-453
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-34
Family Laminin G-like module 0.0000137
Further Details:      
 
Domain Number 2 Region: 467-667
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.56e-27
Family Laminin G-like module 0.0000409
Further Details:      
 
Domain Number 3 Region: 41-95
Classification Level Classification E-value
Superfamily GLA-domain 1.51e-20
Family GLA-domain 0.00039
Further Details:      
 
Domain Number 4 Region: 120-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000157
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026761   Gene: ENSMMUG00000020334   Transcript: ENSMMUT00000028602
Sequence length 674
Comment pep:known chromosome:MMUL_1:2:14335822:14391596:-1 gene:ENSMMUG00000020334 transcript:ENSMMUT00000028602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLGGRCGALLAYLLLVLPVSEANFLSKQQASQVLVRKRRANSMLEETKQGNLERECIE
ELCNKEEAREVFENDPETDYFYPKYLVCLRSFQSGLFTAARQSTDAYPDLRSCVNAIPDQ
CSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPG
SYHCSCKSGFVMLSNKKDCKDVDECSLKPNMCGTAVCKNIPGDFECECPEGYRYNLKSKS
CEDVDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEAVSVCLPLLDTKYELYL
AEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSQGVILYAESIDHSAWLLIALRGGKIEVQ
LKNEHTSKITTGGDIINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGLLE
TKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKG
SYYPGSGIAEFHIDYNNGSNAEGWHINVTLNIRPSMGTGVMLALVSSNNTVPFAVSLVDS
TSEKSQDIVISVENTVIYRIQALSLCSNQRSHLEFRVNRNNLELLTPLKIETISQEELQT
QLAILDKAMKGKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVELDLDEAISKHNDIR
AHSCPSVWKKTKNS
Download sequence
Identical sequences 9544.ENSMMUP00000026760 ENSMMUP00000026761 ENSMMUP00000026760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]