SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026766 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026766
Domain Number 1 Region: 35-93
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000759
Family Thyroglobulin type-1 domain 0.0000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026766   Gene: ENSMMUG00000020338   Transcript: ENSMMUT00000028608
Sequence length 95
Comment pep:known chromosome:MMUL_1:11:50160583:50161951:1 gene:ENSMMUG00000020338 transcript:ENSMMUT00000028608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENPKESKLQAGTGRPQDANRRNQQKNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQL
QTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRR
Download sequence
Identical sequences ENSMMUP00000026766 ENSMMUP00000026766 9544.ENSMMUP00000026766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]