SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026774 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026774
Domain Number 1 Region: 314-643
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.95e-71
Family Pancreatic carboxypeptidases 0.00000215
Further Details:      
 
Domain Number 2 Region: 135-296
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00016
Further Details:      
 
Domain Number 3 Region: 643-732
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.16e-19
Family Carboxypeptidase regulatory domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026774   Gene: ENSMMUG00000020346   Transcript: ENSMMUT00000028617
Sequence length 756
Comment pep:known chromosome:MMUL_1:9:123345448:123491576:-1 gene:ENSMMUG00000020346 transcript:ENSMMUT00000028617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPGTATPALALVLLAVTVAGVGAQGAALEDPDYYGQEIWSQEPYYTRPEPEPETFSPP
LPAGPGEEWEPRPQEPRAPKRATKPKKAPKREKSAPEPPPPGKNSNKKVMRTKSSEKAAN
DDHSVRVAHEDVRESCPPLGLETLKITDFQLHASTVKRYGLGAHRGRLNIQAGINENDFY
DGAWCAGRNDLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVK
NGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPRSWFDNGSICMRMEILGCPLPDPNN
YYHRRNEMTTTDDLDFKHHNYKEMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYAVEISD
HPGEHEVGEPEFHYIAGAHGNEVLGRELLLLLVQFLCQEYLARNARIVHLVEETRIHILP
SLNPDGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEAEDQQNGPRKVPNHY
IAIPEWFLSENATVAAETRAVIAWMEKIPFVLGGNLQGGELVVAYPYDLVRSPWKTQEHT
PTPDDHVFRWLAYSYASTHRLMTDARRRVCHTEEFQKEEGTVNGASWHTVAGSLNDFSYL
HTNCFELSIYVGCDKYPHESQLPEEWENNRESLIVFMEQVHRGIKGLVRDSHGKGIPNAI
ISVEGVNHDIRTANDGDYWRLLNPGEYAVTAKAEGFTASTKNCMVGYDMGATRCDFTLSK
TNMARIREIMEKFGKQPISLPARRLKLRGRKRRQRG
Download sequence
Identical sequences A0A2K5U0F7 F6W9K4
9544.ENSMMUP00000026774 ENSMMUP00000026774 XP_001082168.1.72884 XP_005566731.1.63531 ENSMMUP00000026774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]