SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026776 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026776
Domain Number 1 Region: 537-778
Classification Level Classification E-value
Superfamily HCP-like 2.44e-31
Family HCP-like 0.0013
Further Details:      
 
Domain Number 2 Region: 750-865
Classification Level Classification E-value
Superfamily HCP-like 0.000000000183
Family HCP-like 0.01
Further Details:      
 
Domain Number 3 Region: 148-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000491
Family Laminin G-like module 0.065
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026776
Domain Number - Region: 432-505
Classification Level Classification E-value
Superfamily HCP-like 0.000641
Family HCP-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026776   Gene: ENSMMUG00000020349   Transcript: ENSMMUT00000028619
Sequence length 997
Comment pep:known chromosome:MMUL_1:5:20528362:20629067:-1 gene:ENSMMUG00000020349 transcript:ENSMMUT00000028619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHLHTSRTQIVHVKFPSIMVYRDDYFIRHSISVSAVIVRAWITHKYSGGDWNVKWEENLL
HAVAKNYTLLQTIPPFERPFKDHQVCLEWNMGYIWNLQANRIPQCALENDVVALLGFPYA
SSGENTGIVKKFPRFQNRELEATRRQRMDYPVFTVSLWLYLLHYCKANLCGILYFVDSNE
MYGTPSVFLTEEGYLHIQMHLVKGEDLAVKTKFIVPLKEWFRLDISFNGGQIVVTTSIGQ
DLKSYHNQTISFREDFHYNDTAGYFIIGGSRYVAGIEGFFGPLKYYRLRSLHPAQIFNPL
LEKQLAEQIKLYYERCAEVQEIVSVYASAALRGGERQEACHLHNSYLDLQRKYGRPSMCR
AFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVLEIGGKIFEKAVKRLSSVDGLHQIS
SVVPFLMDSSCCGYHKASYYLAVFYETGLNVPRDQLQGMLYSLVGGQGSERLSSMNLGYK
HYQGIDNYPLDWELSYAYYSNIATKTPLDQHTLQGDQAYVETIRLKDDEILKVQTKEDGD
VFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAAIEWYAKGALETEDPALIYDYAI
VLFKGQGVKKNRRLALELMKKAASKGLHQAVNGLGWYYHKFKKNYAKAAKYWLKAEEMGN
PDASYNLGVLHLDGIFPGVPGRNQTLAGEYFHKAAQGGHMEGTLWCSLYYITGNLETFPR
DPEKAVVWAKHVTEKNGYLGHVIRKGLNAYLEGTWHEALLYYVLAAETGIEVSQTNLAHI
CEERPDLARRYLGVNCVWRYYNFSVFQIDAPSFAYLKMGDLYYYGHQNQSQDLELSVQMY
AQAALDGDSQGFFNLALLIEEGTIIPHHILDFLEIDSTLHSNNISILQELYERCWSHSNE
ESFSPCSLAWLYLHLRLLWGAVLHSALIYFLGTFLLSILIAWTVQYFQSVSASDPPPRPS
WASPDTATSTASPAVTPAADASDQDQPTVTNNLEPRG
Download sequence
Identical sequences 9544.ENSMMUP00000026776 ENSMMUP00000026776 ENSMMUP00000026776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]