SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026780 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026780
Domain Number 1 Region: 196-363
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-29
Family SPRY domain 0.068
Further Details:      
 
Domain Number 2 Region: 394-445
Classification Level Classification E-value
Superfamily RING/U-box 0.000000989
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026780
Domain Number - Region: 98-180
Classification Level Classification E-value
Superfamily ARM repeat 0.000139
Family Armadillo repeat 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026780   Gene: ENSMMUG00000020353   Transcript: ENSMMUT00000028623
Sequence length 453
Comment pep:known chromosome:MMUL_1:20:55574995:55598192:1 gene:ENSMMUG00000020353 transcript:ENSMMUT00000028623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDSISKKKKLCGF
SGEILKEKRKLTAKYRGIAQLLTSHIVEDCLGPASIGLLSPGILEYLLQCLKLQSHPTVM
LFALIALEKFAQTSENKLTISESSISDRLVTLESWANDPDYLKRQVGFCAQWSLDNLFLK
EGRQLTYEKVNLSSIRAMLNSNDVSEYLKISPHGLEARCDASSFESVRCTFCVDAGVWYY
EVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHIHPCWK
EGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGAKPF
KYPPSMKFSTFNDYAFLTAEEKIILPRHRRLALLKQVSIRENCCSLCCDEVADTQLKPCG
HSDLCMDCALQLETCPLCRKEIVSRIRQISHIS
Download sequence
Identical sequences 9544.ENSMMUP00000026781 ENSMMUP00000026781 ENSMMUP00000026780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]