SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026786 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026786
Domain Number 1 Region: 127-310
Classification Level Classification E-value
Superfamily PH domain-like 6.83e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000176
Further Details:      
 
Domain Number 2 Region: 480-591
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-27
Family SH2 domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026786   Gene: ENSMMUG00000020357   Transcript: ENSMMUT00000028629
Sequence length 598
Comment pep:known chromosome:MMUL_1:15:97476469:97685374:-1 gene:ENSMMUG00000020357 transcript:ENSMMUT00000028629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPPAPRAPA
MSTARKGRPGDEPLPRPPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGEGSDHPYYNSIPSKMPPPGGFLDARL
KPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQAPFRQNERQGSLDIYSMPEGKLHVA
PTGEAPTYVNTQQIPPQAWPTVVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVE
CISPVSPRAPDAKMLEDLQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGM
HNGQAKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
Download sequence
Identical sequences A0A2K5WVX6 A0A2K6CQU2 F6W915
9544.ENSMMUP00000026786 NP_001252619.1.72884 XP_005582165.1.63531 XP_011769452.1.29376 ENSMMUP00000026786 ENSMMUP00000026786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]