SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026820 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026820
Domain Number 1 Region: 40-111
Classification Level Classification E-value
Superfamily SNARE fusion complex 8.29e-17
Family SNARE fusion complex 0.003
Further Details:      
 
Domain Number 2 Region: 187-258
Classification Level Classification E-value
Superfamily SNARE fusion complex 5.61e-16
Family SNARE fusion complex 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026820   Gene: ENSMMUG00000020384   Transcript: ENSMMUT00000028665
Sequence length 258
Comment pep:known chromosome:MMUL_1:10:65031468:65062438:-1 gene:ENSMMUG00000020384 transcript:ENSMMUT00000028665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDEPDAPADRQQYLRQEVLRRAEATAAST
SRSLALMYESEKVGVASSEELVRQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLV
NYFKSKPAEAPPEQNGTLASQPNSRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGA
GSAVSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTK
VDKLDVNIKSTERKVRQL
Download sequence
Identical sequences A0A0D9RLD0 F6UFJ7 G7PHA7
NP_001248290.1.72884 XP_005567947.1.63531 XP_007973126.1.81039 ENSMMUP00000026820 ENSMMUP00000026820 9544.ENSMMUP00000026820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]