SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026868 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026868
Domain Number 1 Region: 5-228
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.69e-68
Family IMD domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026868   Gene: ENSMMUG00000020416   Transcript: ENSMMUT00000028715
Sequence length 720
Comment pep:known chromosome:MMUL_1:20:71957175:71976369:1 gene:ENSMMUG00000020416 transcript:ENSMMUT00000028715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIGSALTRMC
MRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSD
TLKLQKKARKELLGKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFIT
FLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPPASEQVIKDLKGSDYSWSYQTPP
SSPSSSSSRKSSMCSAPSSSSSAKGGGAPWPGGAQTYSPSSTCRYRSLAQPATTTTRLSS
VSSHDSGFVSQDATYSKPPSPMPSDITSQKSSSSASSEASETCQSVSECSSPTSDWSKVG
SHEQPSGATLQRRKDRVELLRDTEPGPASGGTLGPSGEEAPRPRMSPATIAAKHSEEVSP
AASDLAMVLTRGLSLEHQKSSRDSLQYSSGYSTQTTTPSCSEDTIPSQGSDYDCYSVNGD
ADSEGPPEFDKSSTIPRNSNIAQNYRRLIQTKRPASTAGLPTATGLPSGAPPGVATIRRT
PSTKPTVRRALSSAGPIPIRPPIVPVKTPTVPDSPGYMGPTRAGSEECVFYTDETASPLA
PDLAKASPKRLSLPNTAWGSPSPEAAGYPGAGAEDEQQQLAANRHSLVEKLGELVAGAHA
LGEGQFPFPTALSATPTEETPTPPPAATSDPPAEDMLVAIRRGVRLRRTVTNDRSAPRIL
Download sequence
Identical sequences 9544.ENSMMUP00000026872 ENSMMUP00000026868 ENSMMUP00000026872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]