SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026894 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026894
Domain Number 1 Region: 296-756
Classification Level Classification E-value
Superfamily Amine oxidase catalytic domain 1.44e-155
Family Amine oxidase catalytic domain 0.000000446
Further Details:      
 
Domain Number 2 Region: 135-293
Classification Level Classification E-value
Superfamily Amine oxidase N-terminal region 1.19e-51
Family Amine oxidase N-terminal region 0.0063
Further Details:      
 
Domain Number 3 Region: 20-125
Classification Level Classification E-value
Superfamily Amine oxidase N-terminal region 1.63e-32
Family Amine oxidase N-terminal region 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026894   Gene: ENSMMUG00000020435   Transcript: ENSMMUT00000028742
Sequence length 769
Comment pep:known chromosome:MMUL_1:3:187809799:187814114:1 gene:ENSMMUG00000020435 transcript:ENSMMUT00000028742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PALGWAVAAILMLQMAMAEPSLGTLHRKAGVFSDLSNQELKAVHSFLWSKKELRLQPSRA
PTMTKNTVFLIEMLLPKKHHVLRFLDKGERQPVREARAVIFFGDQEHPNITEFAVGPLPG
PRYLRALSPRPGHQSSWASRPVSTAEYALLSHTLQEATKPLHQFFLNTTGFSFQDCHDRC
LAFTDVAPRGMASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDARHWAVEQVWYNGK
FYGSPEELARKYADGEVDVVVLEDPLPRGKGHESTEEPPLFSSYKPRGDFPSPIHVSGPR
FVQPHGPRFRLEGNAVLYGGWSFAFRLRSSSGLQVLNVQFGGERIAYEVSVQEAVALYGG
HTPAGMQTKYLDVGYGLGSLTHELAPGIDCPETATYLDTFHYYDSDDPVHYPRALCLFEM
PTGVPLRRHFNSNFKGGFNFYAGLKGQALVLRTTSTVYNYDYIWDFIFYPNGVMEAKMHA
TGYVYATFYTPEGLRHGTRLHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENITN
PWSPRHRVVQPTVEQTRYSRERQAAFRFKRKLPRYLLFTSPQENPWGHKRSYRLQIHSMA
DQVLPPGWQEEQAITWARKKGGQPRPLSQAALPLPGRYPLAVTKYRESELCSSSIYHQND
PWDPPVVFEKFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNFF
PEDPSLASRDTVIVWPRDNGPNHVQRWIPEDRDCSMPPPFSYNGTYRPV
Download sequence
Identical sequences ENSMMUP00000026896 9544.ENSMMUP00000026896 ENSMMUP00000026894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]