SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026899 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026899
Domain Number 1 Region: 120-224
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-30
Family Fibronectin type III 0.000000722
Further Details:      
 
Domain Number 2 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-29
Family C2 set domains 0.00000531
Further Details:      
 
Domain Number 3 Region: 435-611
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-18
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 4 Region: 242-329
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-16
Family Fibronectin type III 0.00000222
Further Details:      
 
Domain Number 5 Region: 327-425
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000305
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026899   Gene: ENSMMUG00000020434   Transcript: ENSMMUT00000028747
Sequence length 865
Comment pep:known chromosome:MMUL_1:1:39334223:39337320:-1 gene:ENSMMUG00000020434 transcript:ENSMMUT00000028747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLRTCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDLEPQ
ILWRLGAELQPGGRQQRLSDGSQQSTITLPHLNHTRAFLSCCLNWGNSLQILDQVELRAG
YPPAVPRNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSIMDCVPE
DGQSHCSIPRRHLLLYQNMGIWVQAENALGTSMSPQLCLEPMDVGGIKNPALRMLDSSFP
EAAPPQAGCLQLCWEPWQPALHINQKCELRHKPQSGEASWALVGPLPLEALRYELCGLLP
ATAYTLQIRCIRWPLPGHWSNWSPSLELRTTERAPAVRLNTWWRQRQLDPRTVQLFWKPV
PLEEDSGQIQGYVVSWRPSGQAGAILPLCNTTELSCTFPLPSEAQEVALVAYNSAGTSCP
TPVVFSESRGPALTRLHAMARDPHSLWVGWEPPSPWPRGYVIEWGLSPPSTSNSNKTWRM
EQNGSATGFLLQENIRPFQLYEITVTPLYQDAMGPSQHVYAYSQEMAPRHAPELHLKHIG
KTWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSTILNASSRGFVLHGLEPASLYHIH
LMAASQAGATNGTVLTLMTLIPEGSELHILLGLFGLLLLLSCLCGTAWLCCSPSRKNPLW
PSVPDPAHSSLGSWWNPLMSPQLPGPRQGRWLGQTSERSRALTPHPCVQEAFQLPGLGMP
PITKLTVLEEDEKKPLPWESHNSSETCGLPTLVQTYVLQGDLRAASAQPQSQSGTSNQVL
YGQLLGSPTSPGPGHYLRCDSTQPLLAGLTPSPKSYENLWFQASPLGTLVTPAPSQEDDC
VFGPLLDFPLLQGIRVHGVEGLESF
Download sequence
Identical sequences ENSMMUP00000026898 9544.ENSMMUP00000026898 ENSMMUP00000026899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]