SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026931 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026931
Domain Number 1 Region: 460-682
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-59
Family Tandem AAA-ATPase domain 0.0000549
Further Details:      
 
Domain Number 2 Region: 684-983
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-35
Family Tandem AAA-ATPase domain 0.00063
Further Details:      
 
Domain Number 3 Region: 365-427
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000726
Family Chromo domain 0.0053
Further Details:      
 
Domain Number 4 Region: 288-359
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000507
Family Chromo domain 0.017
Further Details:      
 
Domain Number 5 Region: 2363-2414
Classification Level Classification E-value
Superfamily BRK domain-like 0.0000214
Family BRK domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026931   Gene: ENSMMUG00000020458   Transcript: ENSMMUT00000028780
Sequence length 2689
Comment pep:known chromosome:MMUL_1:10:22903412:23018407:1 gene:ENSMMUG00000020458 transcript:ENSMMUT00000028780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMKIQKKEKQLSNLKVLNHSPMSDASVNFDYKSPSPFDCSTDQEEKIEDVASHCLPQKD
LYTAEEEAATLFPRKMTSHNGMEDSGGGGTGVKKKRKKKEPGDQEGAAKGSKDREPKPKR
KREPKEPKEPRKAKEPKKAKEHKEPKQKDGVKKARKPREASGTKEAKEKRSCTDSAARTK
SRKASKEQGPTPVEKKKKGKRKSETTVESLELDQGLTNPSLRSPEESTESTDSQKRRSGR
QVKRRKYNEDLDFKVVDDDGETIAVLGAGRTSALSASTLAWQAEEPPEDDANIIEKILAS
KTVQEVHPGEPPFDLELFYVKYRNFSYLHCKWATMEELEKDPRIAQKIKRFRNKQAQMKH
IFTEPDEDLFNPDYVEVDRILEVAHTKDAETGEEVTHYLVKWCSLPYEESTWELEEDVDP
AKVKEFESLQVLPEIKHVERPASDSWQKLEKSREYKNSNQLREYQLEGMNWLLFNWYNRK
NCILADEMGLGKTIQSITFLSEIFLRGIHGPFLIIAPLSTITNWEREFRTWTEMNAIVYH
GSQISRQMIQQYEMVYRDAQGNPLSGVFKFHVVITTFEMILADCPELKKIHWSCVIIDEA
HRLKNRNCKLLEGLKLMALEHKVLLTGTPLQNSVEELFSLLNFLEPSQFPSETAFLEEFG
DLKTEEQVKKLQSILKPMMLRRLKDDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFS
FLTKGANQHNMPNLINTMMELRKCCNHPYLINGAEEKILEDFRKTHSPDAPDFQLQAMIQ
AAGKLVLIDKLLPKLIAGGHKVLIFSQMVRCLDILEDYLIQRRVNFMTYDSRVRSQALST
IARRSCFVDSSQFVFALCFLMMNFRLSYCKEDLCNTVDQVQNFKNKISAQARCHRIGQSK
AVKVYRLITRNSYEREMFDKASLKLGLDKAVLQDINRKGGTNGVQQLSKMEVEDLLRKGA
YGALMDEEDEGSKFCEEDIDQILQRRTHTITIQSEGKGSTFAKASFVASGNRTDISLDDP
NFWQKWAKIAELDTEAKNEKESLVIDRPRVRKQTKHYNSFEEDELMEFSELDSDSDERPT
RSRRLNDKARRYLRAECFRVEKNLLIFGWGRWKDILTHGRFKWHLNEKDMEMICRALLVY
CVKHYKGDEKIKSFIWELITPTKDGQAQTLQNHSGLSAPVPRGRKGKKTKNQLLIPELKD
ADWLATCNPEVVLHDDGYKKHLKQHCNKVLLRVRMLYYLKAEILGEAAEKAFEGTPAREL
DVPLPDIDYMEIPVDWWDAEADKSLLIGVFKHGYERYNAMRADPALCFLEKVGMPDEKSL
SAEQGVTDGTSDIPERGNTDKEDNAEDKVDGLQKQTESSSDGGDGIFGEKKDDSRAAQDG
SDPDKSPWPVSSALTARLRRLVTVYQRCNRKELCRPEILGPGSQGYWVQEEMFRRTSEMD
LINKEAQKRWTRREQADFYRTVSSFGVVYDQEKKTFDWTQFRIISRLDKKSDESLEQYFY
SFVAMCRNVCRLPTWKDGGEKTLSILSDDTRKEHSDFQIRITLGIPIKTRVYMRNLKMSG
LLEIHKLLIGSTHKIKSLSQNDVTSVKVEIQLKISDTQAPNLCCLYQTNSKLYESLTYTQ
MSRTSESLENEPENLVKVESRDDHLSLPDVTCENFISKVQDVISINHDESLLPESLESMM
YGKKVLSQEPGSFRESPSTNTECRKDVITISISKDGNCQPGGHEAEIASGPTFMGSLEAG
GVAQANIKNGKHLLMSISKEEDLCFSEAGQRPESISQLEAKCLASSSLNPGNESGFVDMC
SLSVCDSKRNLSSDQQLIDLLENKSLESKLILSQNHSDEEEEEEENEEENLAMAVGMGER
PEVLHLTEPTIDISREKNQGFHADETKKGSLEVANQTPGLQRAFPPPAACQCHCKHMERW
MHGLENDEFEIEKPKAYIPDLFKSKTSTIAMEGEPTAVASEPFKVKHELLKEPWKEGAEG
QKVFPTYPLEGSELKAEDMDFENKDEYDRDGNCHSQDYPGKYSEEESKSSTSGIAGDIGD
ELQEARAPTIAQLLQEKTLYSFSEWPKDRVIINRLDNICHVVLKGKWPSSQQYEPSGTLP
TPVLTSSVGSRTSLSEPEAAEHSFSNGAALAAQIQKESFLAPVFTKDEQKHRRPYEFEVE
RDAKARGLEQFSATHGHTPIILNGWHGESAMDLSCSSEGSPGATSPFPVSTSTPKIGAIS
SLQGALGMDLSGILQAGLIHPVTGQIVNGNLRRDDAATRRRRGRRKHVEGGMDLIFLKEQ
TLQAGILEVHEDPGQATLSTTHPEGPGPATSAPEPATAASSQAEKAIPSKSLLDWLRQQA
DYSLEVPGFGANFSDKPKQRRPRCKEPGKLDVSSLSGEERVPAVPKEPGLRGFLPENKFN
HTLGEPVLRDTGPRRRGRRPRSELLKAPSIVADSPSGMGPLFMNGLIAGMDLVGLQNMRN
MPGIPLTGLVGFPAGFATMPTGEEVKSTLSMLPMMLPGMAAVPQMFGVGGLLSPPMATTC
TSTAPASLSSTTKSGTAVTEKTARDKPSSHDVKTDTLAEDKPGPGPFSDQSEPAITTSSP
VAFNPFLIPGVSPGLIYPSMFLSPGMGMALPAMQQARHSEIVGLESQKRKKKKTKGDNPN
SHPEPAPSCEREPSSDENCAEPSALLPAEREHVAQAGEGAPKDSNDDTN
Download sequence
Identical sequences ENSMMUP00000026931 ENSMMUP00000026935 9544.ENSMMUP00000026935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]