SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026958 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026958
Domain Number 1 Region: 412-677
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.26e-62
Family Extended AAA-ATPase domain 0.00000178
Further Details:      
 
Domain Number 2 Region: 953-1085
Classification Level Classification E-value
Superfamily Bromodomain 2.62e-19
Family Bromodomain 0.0014
Further Details:      
 
Domain Number 3 Region: 779-929,956-1010
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000114
Family Extended AAA-ATPase domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026958   Gene: ENSMMUG00000020467   Transcript: ENSMMUT00000028808
Sequence length 1379
Comment pep:known chromosome:MMUL_1:8:125901491:125980137:-1 gene:ENSMMUG00000020467 transcript:ENSMMUT00000028808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLRSSLELHNHSAASATDSLDLSNEFLSLEQIGRRRLRSAGAAQKQPVATTAKAGDGS
SVKEVGTYHRTRALRALRKDAQNSSDSSFEKNVEITEQLGNGRHFTRQLARQQADKKKEE
RREDKVIPVTRSLRTRNIVQSSEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNT
AEAVLQKMDDMKKMRRQRMRELEDLGVFNETEESNLNMYTRGKQKDIQRTDEETTDNQEG
SVESSEEGEDQEHEDDGEDEDDEDDDDEDDEDEEDGEDNQKRYYLRQRKATVYYQAPLEK
PRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNRRRHAIHSSDSTSSSSSEDEQH
FERRRKRSRNRAINRCLPLNFRKDELKGMYKDRMKIGASLADVDPMQLDSSVRFDSVGGL
SSHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDKRV
AFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSI
VSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKEARKEILKIH
TRDWNPKPLDTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSS
INISAKDFEVAMQKMIPASQRAVTSPGQALSTIVKPLLQSTVDKILEALQRVFPHAEFRT
NKTLDSDISCPLLESDLAYSDDDVPSVYDNGLSQKSSHKAKDNFNFLHLNRNACYQPMSF
RPRILIVGEPGFGQGSHLAPGVIHALEKFTVYTLDIPVLFGVSATSPEETCAQVIREAKR
TAPSIVYVPHIHLWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQELF
IRDYGEIFNVQLPGKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLPVAPPPEPRSLT
AEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTIKQQWDLS
SVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEE
LDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLAGDKRSDPEQNEKLKTPST
PMACSTPAQLKRKIRKKSKWYLGTIKKRRKISQAKDDSQNAMDHKIESDTEETQDTSVDH
NETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTACTELRREKTACN
GDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLISVEKALAILSQPTPSLVVDHE
RLKNLLKTVVKKSRNYNIFQLENLYAVISQCIYQHRKDYDKTSLIQKMEQEVENFSCSR
Download sequence
Identical sequences ENSMMUP00000026958 ENSMMUP00000026958 9544.ENSMMUP00000026958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]