SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026976 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026976
Domain Number 1 Region: 52-323
Classification Level Classification E-value
Superfamily Kelch motif 1.37e-58
Family Kelch motif 0.0011
Further Details:      
 
Domain Number 2 Region: 666-736,772-802
Classification Level Classification E-value
Superfamily POZ domain 3.73e-21
Family BTB/POZ domain 0.0092
Further Details:      
 
Domain Number 3 Region: 429-573
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000141
Family BTB/POZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026976   Gene: ENSMMUG00000020482   Transcript: ENSMMUT00000028828
Sequence length 844
Comment pep:known chromosome:MMUL_1:10:64904709:64920919:-1 gene:ENSMMUG00000020482 transcript:ENSMMUT00000028828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPGSTGGQIGPGALAGGARSKVAPSVDFDHSCSDSVEYLTLNFGPFETVHRWRRLPPC
DEFVGARRSKHTVVAYKDAIYVFGGDNGKTMLNDLLRFDVKDCSWCRAFTTGTPPAPRYH
HSAVVYGSSMFVFGGYTGDIYSNSNLKNKNDLFEYKFATGQWTEWKIEGRLPVARSAHGA
TVYSDKLWIFAGYDGNARLNDMWTIGLQDRELTCWEEVAQSGEIPPSCCNFPVAVCRDKM
FVFSGQSGAKITNNLFQFEFKDKTWTRIPTEHLLRGSPPPPQRRYGHTMVAFDRHLYVFG
GAADNTLPNELHCYDVDFQTWEVVQPSSDSEVRAAGWTPPWTPAPASSPSFTPQPAGGAA
SLPLPGCTSPTVEALPPIPPCLLVPQLPSGRLFHAAAVISDAMYIFGGTVDNNIRSGEMY
RFQFSCYPKCTLHEDYGRLWESRQFCDVEFVLGEKEECVQGHVAIVTARSRWLRRKITQA
RERLAQKLEQEAASVPREAPGVAAGGTRPPLLHVAIREAEARPFEVLMQFLYTDKIKYPR
KGHVEDVLLIMDVYKLALSFQLCRLEQLCRQYIEASVDLQNVLVVCESAARLQLSQLKEH
CLNFVVKESHFNQVIMMKEFERLSSPLIVEIVRRKQQPPPRTPSDQPVDIGTSLIQDMKA
YLEGAGAEFCDITLLLDGHPRPAHKAILAARSSYFEAMFRSFMPEDGQVNISIGEMVPSR
QAFESMLRYIYYGETVFFWGGDSCYLFAAPYYYGFYNNRLQAYCKQNLEMNVTVQNVLQI
LEAADKTQALDMKRHCLHIIVHQFTKVSKLPTLRSLSQQLLLDIIDSLASHISDKQCAEL
GADI
Download sequence
Identical sequences ENSMMUP00000026976 ENSMMUP00000026976 9544.ENSMMUP00000026976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]