SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027021 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027021
Domain Number 1 Region: 102-422
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.06e-61
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000424
Further Details:      
 
Domain Number 2 Region: 417-554
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.72e-25
Family Ricin B-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027021   Gene: ENSMMUG00000020516   Transcript: ENSMMUT00000028875
Sequence length 558
Comment pep:known chromosome:MMUL_1:7:132389905:132479614:1 gene:ENSMMUG00000020516 transcript:ENSMMUT00000028875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKIRANAIAILTVAWILGTFYYLWQDNRAHAASSGGRGAQRAGGRPEQLREDRTIPLIV
TGTPSKGFDEKAYLLAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSS
DLPATSVIITFHNEARSTLLRTVKSVLNRTPANLIQEIILVDDFSSDPEDCLLLTRIPKV
KCLRNDRREGLIRSRVRGADVAAATVLTFLDSHCEVNTEWLPPMLQRVKEDHTRVVSPII
DVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTRTDPTRPIRTPVIAGGIFVID
KSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKRHPYNFPEGNA
LTYIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVATRIEQRKKMNCKSFRWYLENVY
PELTIPVKEALPGIIKQGPNCLESQGQSTAGDFLLGMGICRGSAKNPQPAQAWLFSDHLI
QQQGKCLAATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVT
SKCQADAQAQQWQLLPHT
Download sequence
Identical sequences F7AFB0
XP_001104403.2.72884 XP_014999458.1.72884 ENSMMUP00000027023 ENSMMUP00000027021 9544.ENSMMUP00000027023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]