SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027026 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027026
Domain Number 1 Region: 29-176
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.13e-47
Family VHS domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 192-320
Classification Level Classification E-value
Superfamily GAT-like domain 1.26e-36
Family GAT domain 0.00000978
Further Details:      
 
Domain Number 3 Region: 416-433,484-576
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 3.14e-28
Family gamma-adaptin C-terminal appendage domain-like 0.0000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027026   Gene: ENSMMUG00000020521   Transcript: ENSMMUT00000028881
Sequence length 577
Comment pep:known chromosome:MMUL_1:20:21966327:22009513:-1 gene:ENSMMUG00000020521 transcript:ENSMMUT00000028881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATAVAAGAGAVAGTESAQGPPGPAAALELWLNKATDPSMSEQDWSAIQNFCEQVNTDP
NGPTHAPWLLAHKIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPK
YLGSWATEKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKLPVDKILPPPS
PWPKSSIFDADEEKSKLLTRLLKSNHPEDLQAANRLIKNLVKEEQEKSEKVSKRVSAVEE
VRSHVKVLQEMLSMYRRPGQALPDQEALQVVYERCEKLRPTLFRLASDTTDDDDALAEIL
QANDLLTQGVLLYKQVMEGRVTFGNRVTSSVGDIPVSRVFQNPTGCMKTCPLIDLEVDNG
PAQAGTVAPSLLHQDLAALGISDAPVTGTVAGQNCCEEKRNPSSSTLPGGGVQNPSADRN
LLDLLSPQPAPGPLGRVAEKFSPGHVLHGEAVASGDNMYISFQPGCLGGFVVVLTLLLVP
SLPGSLPPLIVYDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPK
SMRVKLQPASSSKLPAFSPLMPPAVISQMLLLDNPHK
Download sequence
Identical sequences 9544.ENSMMUP00000027026 ENSMMUP00000027026 ENSMMUP00000027026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]