SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027202 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027202
Domain Number 1 Region: 25-190
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027202   Gene: ENSMMUG00000020673   Transcript: ENSMMUT00000029075
Sequence length 206
Comment pep:known chromosome:MMUL_1:10:64469127:64473506:-1 gene:ENSMMUG00000020673 transcript:ENSMMUT00000029075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKFSVKFTSREFSLKKMLSPKQTGFGVKIAVVTKRERSKVLYIVCQCVEEIKRRGMEEVG
IYCVSGVATDIQALKAAFDINNKDVSVMMSEMDVNAIAGTLKLYFHELPEPLFTDEFYPN
FTEGIALSDPIAKESCLLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKKSLHNLAMIF
GPTLLRPSEKESKLPANPSQPITMTD
Download sequence
Identical sequences ENSMMUP00000027202 ENSMMUP00000027202 9544.ENSMMUP00000027202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]