SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027363 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027363
Domain Number 1 Region: 110-216
Classification Level Classification E-value
Superfamily Fibronectin type III 3.84e-19
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 214-309
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000902
Family Fibronectin type III 0.00015
Further Details:      
 
Domain Number 3 Region: 32-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000114
Family I set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027363   Gene: ENSMMUG00000020790   Transcript: ENSMMUT00000029245
Sequence length 422
Comment pep:known chromosome:MMUL_1:15:42861704:42869972:-1 gene:ENSMMUG00000020790 transcript:ENSMMUT00000029245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGCSGLSRVLVAVATALVSASSSCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF
RDGEPRLLQGPDSGLGHELVLTQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGFPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEMITDAVAGLPHAVRVSARDFLD
AGTWSTWSPEAWGTPSTGTVPKEVPAWGQLHMQPEVEPQVDSPAPPSPSLQPHPRLLDHR
DSVEQVAVLASLGILSFLGLMAGALALGLWLRMRRGGKDGSPKPGFLAPMIPVDRRPGAP
NL
Download sequence
Identical sequences A0A2I3MYJ9 A0A2K5LJW8 A0A2K5VLM5 A0A2K5XMC5 F7H9Z9
ENSMMUP00000027363 XP_005581498.1.63531 XP_011835460.1.47321 XP_011924617.1.92194 XP_014973011.1.72884 9544.ENSMMUP00000027362 ENSMMUP00000027362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]