SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027399 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027399
Domain Number 1 Region: 160-479
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.2e-44
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000176
Further Details:      
 
Domain Number 2 Region: 488-618
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000013
Family Ricin B-like 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027399
Domain Number - Region: 97-156
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.0924
Family YheA-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027399   Gene: ENSMMUG00000020815   Transcript: ENSMMUT00000029284
Sequence length 630
Comment pep:known chromosome:MMUL_1:11:4824838:4886248:1 gene:ENSMMUG00000020815 transcript:ENSMMUT00000029284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFWRKRSKALCIGLTLAITVNLLLVFFSKETLRNPFMGGLHKELPLHLNERDGAVIRRL
SQLETELKHLKESMKLALRQQENVNNTMKRAKDEERPVLKAVEAEVNETKKHKTQMKLFP
HSQLFRQWGEDLSEAQQKKAQDLFRKFGYNAYLSNQLPLNRTIPDTRDYRCLQKTYPSQL
PSLSVILIFMNEALSIIQRAITSIINRTPSQLLKEIILVDDFSSNGELKVHLDEKIKLYN
QKYPGLLKIIRHPERKGLAQARNTGWEAATADVVAILDAHIEVNVGWAEPILARIQEDRT
VIVSPVFDNIRFDTFKLDKYELAVDGFNWELWCRYDALPQAWIDRHDVTAPVKSPSIMGI
LAADRNFLGEIGSLDGGMLIYGGENVELSLRVCTFPFSLWDKAERGIIERSDLPCFLYMA
AGIGQDPAVVTEIWIQAQKHLVFYLQNSGIDFGDISSRVALREKLKCKTFDWYLKNVYPL
LKPIHTIVGYGRMKKLLDENVCLDQGPVPGNTPIMHYCHGFSSQNVYYHLTGELYVGQLI
AEASARDRCLADPGNAEKPTLERCSEAARNGLHIYWDFKLGGAVRNRDTKRCLEMKKDLL
GKHVLVLQTCTTQAWEIQHTVGDWGQTNSQ
Download sequence
Identical sequences ENSMMUP00000027399 ENSMMUP00000027399 9544.ENSMMUP00000027399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]