SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027442 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027442
Domain Number 1 Region: 65-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.36e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027442   Gene: ENSMMUG00000020852   Transcript: ENSMMUT00000029329
Sequence length 219
Comment pep:known chromosome:MMUL_1:13:71085594:71097723:-1 gene:ENSMMUG00000020852 transcript:ENSMMUT00000029329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAPGALDPRAAPPALLCAPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENL
QLVLERRRVANAKERERIKNLNRGFAKLKALVPFLPQSRKPSKVDILKGATEYIQVLSDL
LGGAKDSKKQDPDEQSYSNNTSEPHISSARELSRNVTQRISCAFGLKNEEEGPWADGGSG
EPVHTCRQGVMSTTEVISPTRSLDRFPEVELLNHRLPQV
Download sequence
Identical sequences A0A2K6DI62 F7HNH5
ENSMMUP00000027442 ENSMMUP00000027442 XP_001099273.1.72884 XP_011711817.1.29376 9544.ENSMMUP00000027442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]