SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027515 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027515
Domain Number 1 Region: 24-127
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.49e-28
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 149-182
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000745
Family FAD-linked reductases, N-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027515   Gene: ENSMMUG00000020912   Transcript: ENSMMUT00000029407
Sequence length 190
Comment pep:known chromosome:MMUL_1:10:37523661:37527418:1 gene:ENSMMUG00000020912 transcript:ENSMMUT00000029407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEASGLLEETTDGERSVGRISLYSKNGV
ACYLTNHGRRIPKDVVEEFSDLYNEPMQVLFSGEATHRKYYSTTHGALLSGQREAARLIE
MYRDLFQQGT
Download sequence
Identical sequences A0A2I3NCF6 A0A2K5HNA7 A0A2K5KI13 A0A2K5UXH4 A0A2K6A284 A0A2K6DJI0 A0A2K6LRX4 A0A2K6PMS8 F7H4Z9
ENSMMUP00000027515 9544.ENSMMUP00000027516 ENSMMUP00000027516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]