SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027580 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000027580
Domain Number - Region: 308-422
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000748
Family APC10-like 0.076
Further Details:      
 
Domain Number - Region: 193-224
Classification Level Classification E-value
Superfamily MPN010-like 0.0497
Family MPN010-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027580   Gene: ENSMMUG00000020959   Transcript: ENSMMUT00000029475
Sequence length 438
Comment pep:known chromosome:MMUL_1:10:28912393:28917901:-1 gene:ENSMMUG00000020959 transcript:ENSMMUT00000029475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSSRPGSASSSRKHTPNFFSENSSVSITSEDSNGLRSAGPGPGDPEGRGARGPSCGEP
ALSAGVPGGTTWAGSSRQKPAPRSHNWQPACGAATVRGGASEPTGSPAVSEEPLDLLPTL
DLRQEMPPSRVFKSFLSLLFQVLSVLLSLAGDVLVSMYREVCSIRFLFTAVSLLSLFLAA
IWLGLLYLVSPLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSER
VAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTV
ILEPHVFPGNCWAFEGDQGQVVIQLPGRVQLSDITLQHPPPSVEHTGGANSAPRDFAVFG
LQVDDETEVFLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGHPRFTCLYRVRA
HGVRTSEGAEGSATGGPH
Download sequence
Identical sequences ENSMMUP00000027580 ENSMMUP00000027580 9544.ENSMMUP00000027580 XP_001098382.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]