SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027676 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000027676
Domain Number - Region: 101-171
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0327
Family SNARE fusion complex 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027676   Gene: ENSMMUG00000021031   Transcript: ENSMMUT00000029575
Sequence length 227
Comment pep:known chromosome:MMUL_1:1:29643863:29651294:1 gene:ENSMMUG00000021031 transcript:ENSMMUT00000029575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGCRISACGPGAQEGTAEPGSPPPPREPMPFSQPPPPTPTLTPTPTPGQSPPLPDAAGA
SAGAAEGQELQRWRQGASGVAGLAGPGGGSGAAAGTGGRALELAEARRRLLEVEGRRRLV
SELESRVLQLHRVFLAAELRLAHRAESLSRLSGGVAQAELYLAAHGSRLKKGQRRGRRGR
PPALLASALGLGGCVPWGAGRLRRGHGPEPDSPFRRSPPRGPASPQR
Download sequence
Identical sequences A0A2K5KJM1 F7HG56
ENSMMUP00000027676 NP_001252724.1.72884 XP_011935354.1.92194 XP_011935355.1.92194 ENSMMUP00000027676 9544.ENSMMUP00000027676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]