SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027721 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027721
Domain Number 1 Region: 9-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.94e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 124-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000396
Family Laminin G-like module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027721   Gene: ENSMMUG00000021063   Transcript: ENSMMUT00000029621
Sequence length 219
Comment pep:known chromosome:MMUL_1:15:109292003:109400806:-1 gene:ENSMMUG00000021063 transcript:ENSMMUT00000029621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCDAPLASALPRSSFSSSSELSSSHGPGFSRLNRRDGAGGWTPLVSNKYQWLQIDLGERM
EVTAVATQGGYGSSDWVTSYLLMFSDGGRNWKQYRREESIWGFPGNTNADSVVHYRLQPP
FEARFLRFLPLAWNPRGRIGMRIEVYGCAYKSEVVYFDGQSALLYKLDKKPLKPVRDVIS
LKFKAIQSNGILLHREGQHGNHITLELIKGKLVFFLNSG
Download sequence
Identical sequences 9544.ENSMMUP00000027721 ENSMMUP00000027721 ENSMMUP00000027721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]