SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027724 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027724
Domain Number 1 Region: 443-633,725-1046
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.51e-71
Family Tandem AAA-ATPase domain 0.035
Further Details:      
 
Domain Number 2 Region: 71-118
Classification Level Classification E-value
Superfamily UBA-like 0.000000859
Family UBA domain 0.038
Further Details:      
 
Domain Number 3 Region: 198-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000288
Family CCCH zinc finger 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027724
Domain Number - Region: 234-317
Classification Level Classification E-value
Superfamily UBC-like 0.00345
Family UBC-related 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027724   Gene: ENSMMUG00000021066   Transcript: ENSMMUT00000029624
Sequence length 1284
Comment pep:known chromosome:MMUL_1:13:38785381:38851127:-1 gene:ENSMMUG00000021066 transcript:ENSMMUT00000029624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSENQEKVKALLRDLQEQDADAGSERGISGEEEDDEPDCCNDERYWPAGQETSLVPDLD
PLEYAGLAPVEPHVPEFTVSPFAVQKLSRYGFNIERCQAVLRMCDGDVGASLEHLLTQCF
SETFGERMKISEAVNQISLDECMEQRQEEAFALKSICGEKFIERIQNRVWTIGLELEYLT
SRFRKSKPKESTKNVQENSLEICKFYLKGNCKFGSKCKFKHEVPPNQIVGRIERSVDDSH
LNANEDGSFLYELEIRFSKDHKYPYQAPLVAFYSTNENLPLACRLHISEFLYDKALTFAE
TSEPVVYSLITLLEEESEIIKLLTNTHHKYSVPPMNVLPVPSRTRINNPACHKPMIPNNS
FVSNQIPEVEKESESEESDEDEGPAPVIVENESYVNLKKKISKRYDWQAKSVHAENGKIC
KQFRMKQASRQFQSILQERQSLPAWEERETILNLLRKHQVVVISGMTGCGKTTQIPQFIL
DDSLNGPPEKVANIICTQPRRISAISVAERVAKERAERVGLTVGYQIRLESVKSSATRLL
YCTTGVLLRRLEGDTALQGVSHIIVDEVHERTEESDFLLLVLKDIVSQRPGLQVILMSAT
LNAELFSEYFNSCPVITIPGRTFPVDQFFLEDAIAVTRYILQDGSPYMRSMKQISKEKLK
ARRNRTAFEEVEEDLRLSLHLQDQDSVKDAVPDQQLDFKQLLARYKGVSKSVIKTMSIMD
FEKVNLELIEALLEWIVDGKHSYPPGAILVFLPGLAEIKMLYEQLQCNSLFNNRRSNRCV
IHPLHSSLSSEEQQAVFVKPPVGVTKIIISTNIAETSITIDDVVYVIDSGKMKEKRYDAS
KGMESLEDTFVSQANALQRKGRAGRVASGVCFHLFTSHHYNHQLLKQQLPEIQRVPLEQL
CLRIKILEMFSAHNLQSVFSRLIEPPHADSLRASKIRLRDLGALTPDEKLTPLGYHLASL
PVDVRIGKLMLFGSIFRCLDPALTIAASLAFKSPFVSPWDKKEEANQKKLEFAFANSDYL
ALLQAYKGWQLSTREGVRAGYNYCRQNFLSGRVLQEMASLKRQFTELLSDIGFAREGLRA
REIEKRAQGGDGVLDATGEEANSNAENPKLISAMLCAALYPNVVQVKSPEGKFQKTSTGA
VRMQPKSAELKFVTKNDGYVHIHPSSVNYQVRHFDSPYLLYHEKIKTSRVFIRDCSMVSV
YPLVLFGGGQVNVQLQRGEFVVSLDDGWIRFVAASHQVAELVKELRCELDQLLQDKIKNP
SIDLCTCPRGSRIISTIVKLVTTQ
Download sequence
Identical sequences ENSMMUP00000027724 XP_011711292.1.29376 XP_015289254.1.63531 9544.ENSMMUP00000027724 ENSMMUP00000027724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]