SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027798 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027798
Domain Number 1 Region: 1246-1466
Classification Level Classification E-value
Superfamily SET domain 2.88e-69
Family Histone lysine methyltransferases 0.00082
Further Details:      
 
Domain Number 2 Region: 2167-2201
Classification Level Classification E-value
Superfamily WW domain 0.00000000236
Family WW domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027798
Domain Number - Region: 1063-1119
Classification Level Classification E-value
Superfamily Ferritin-like 0.000203
Family Ribonucleotide reductase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027798   Gene: ENSMMUG00000021117   Transcript: ENSMMUT00000029701
Sequence length 2343
Comment pep:known chromosome:MMUL_1:2:89413912:89420096:1 gene:ENSMMUG00000021117 transcript:ENSMMUT00000029701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPVPLPVDVAVRSLKEPPIIIVPESLEADTKQDTVSNSSEEHITQILNEQADISSKKE
DSHIGKDEEIPDSSKISLSCKKTGSKKKSSQSEGTFLGSESDEDSVRTSSSQRSHDLKFS
ASIERERDFKKSSAPLKSEDLGKSSRSKTERDDKYFSYSKLERDTRYVSSRCRSERERRR
SRSHSRSERGPRTNLSYSRSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRARESSDSE
EEYKKTYSRRTSSHSSSYRDLRTSSYSKSDRDCKTETSYLEMERRGKYSSKLERESKRTS
ENEAVKRCCSPPNELGFRRGSSYSKHDSSASRYKSTLSKPIPKSDKFKNSFCCTELNEEI
KQSHSFSLQTPCSKGSELRMINKNPEREKAGSPAPSNRLNDSPTLKKLDEFPIFKSEFIT
HDSHDRIKELDSLSKVRNDQLRSFCPIELNINGSPGAESDLATFCTSKTDAVLMTSDDSV
TGSEVSPLVKACMLSSNGFQNISRCKGKDLDDTRMLHKKSESPFRETEPLVSPHQDKLMS
LPVMTIDYSKTVVKEPVDTRVSCCKTKDSDIYCTSNDSNNPSLCNSEAENIEPSVMKISS
NSFMNVHLESKPVICDSRNLTDHSKFACEEYKQSIGSTSSASVNHFDDLYQPIGSSDIAS
SLQSLPPGIKVDSLTLLKCGENTSPVLDAVLKSRKSSEFLKHAGKETVVEVGSDLPDSGK
GFASRENRRNNGLSGKCLQEAQEEGNSILPDRRGRPEISLHERGEGGRVHTSDDSEVVFS
SCDLNLTMEDSDGVTYALKCDSSGHAPEIVSTAHEDYSDSSESSSDESDSEDTDSDDSSI
PRNRLQSVVVVPKNSTLPVEETSPCSSRSSQSYRHYSDHWEDERLESRRHSYEEKFESIA
NKACPQTDKFFLHKGTEKNPEISFTQSNRKQIDNHLPELSHPQSDGVDSTSHTDVKSDSL
GHPNSEETVKAKISSRQQEELPIYSSDFEDVPNKSWQQSTFQNRPDSRLGKTELSFSSSC
EISRVDGLHSSEELRNLGWDFSQEKPSTTYQQPDSSYGTCGGHKYQQNAEQYGGTRDYWQ
GNGYWDPRSGRPPGTGVVYDRTQGQVPDSLTDDREEEENWDQQDGSHFSDQSNKYLLSLQ
KDKGSVQAPEISSNSIKDTLAVNEKKEFSKNLEKNDIKDRGPLKKRRQEIESDSESDGEL
QDRKKVRVEVEQGETSVPPGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVY
LTERKKNKSHRDIKRMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSN
RRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKN
IHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSE
LTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEA
LMENGEGLSDKNQVLSLCRLMVRIETLEQKLTCLELIQNTHSQSCLKSFLERHGLSLLWI
WMAELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPPLSEGD
GYSSENTSRAHTPLNTPDPSTKLSTEADTDTPKKLMFRRLKIISENSMDSAISDATSELE
GKDGKEDLDQLENVPVEEEEELQSQQLLPQQLPECKVESETNIEASKLPTSEPEADTEIE
PKESNGTKLEEPINEETPSQDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKE
VYRIPKKSQTEKENTTAERGRDAVGFRDQTPAPKTPNRSRERDPEKQTQNKEKRKRRGSL
SPPPSAYERGTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQM
QNLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPA
PYDHAQPMVGHSTEPLSAPPPVPVVPHVAASVEVSSSQYVAQSEGVVHQDSSVAVLPVPA
PGPVQGQNYSVWDSNQQSVSVQQQYSPAQSQATIYYQGQTCPAVYGVTSPYSQTTPPIVQ
SYAQPSLQYIQGQQIFTAHPQGVVVQPAAAVTTIVAPGQPQPLQPSEMVVTNNLLDLPPP
SPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGT
PTYDENPMKTSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITT
TEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDT
ELE
Download sequence
Identical sequences 9544.ENSMMUP00000027793 ENSMMUP00000027793 ENSMMUP00000027798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]