SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027864 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027864
Domain Number 1 Region: 602-808
Classification Level Classification E-value
Superfamily Fibronectin type III 1.33e-32
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 2 Region: 808-990
Classification Level Classification E-value
Superfamily Fibronectin type III 8.98e-26
Family Fibronectin type III 0.00025
Further Details:      
 
Domain Number 3 Region: 240-334
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-20
Family I set domains 0.00053
Further Details:      
 
Domain Number 4 Region: 412-509
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 5 Region: 504-608
Classification Level Classification E-value
Superfamily Immunoglobulin 3.97e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 327-409
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-17
Family I set domains 0.00029
Further Details:      
 
Domain Number 7 Region: 57-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000885
Family I set domains 0.004
Further Details:      
 
Domain Number 8 Region: 136-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000663
Family I set domains 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027864   Gene: ENSMMUG00000021163   Transcript: ENSMMUT00000029772
Sequence length 994
Comment pep:known chromosome:MMUL_1:11:37733204:37935888:1 gene:ENSMMUG00000021163 transcript:ENSMMUT00000029772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGK
VSLNCRARASPFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNSY
GMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPY
PADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGG
IYTCFAENNRGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASSDPALDLTFVW
SFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVV
RGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPIIE
GNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDGAAPNVAPSDVGGGGGRN
RELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMSPSTAF
QVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESY
QIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDTIETFT
KKAPPSQPPRIISSIRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKH
SIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISG
Download sequence
Identical sequences ENSMMUP00000027864 ENSMMUP00000027864 9544.ENSMMUP00000027864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]