SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027949 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027949
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-48
Family G proteins 0.0000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027949   Gene: ENSMMUG00000021227   Transcript: ENSMMUT00000029866
Sequence length 203
Comment pep:known chromosome:MMUL_1:1:164640427:164646590:1 gene:ENSMMUG00000021227 transcript:ENSMMUT00000029866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEIVRLQ
LWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGELVPC
LLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSRED
IMSLSTQGDYINLQTKSSSWSCC
Download sequence
Identical sequences A0A096MPU0 A0A0D9RQD0 A0A2K5MJQ3 A0A2K6ED05 F7HTT7 G7NVC5
NP_001247882.1.72884 XP_005540669.1.63531 XP_005540670.1.63531 XP_005540671.1.63531 XP_005540672.1.63531 XP_007986901.1.81039 XP_007986902.1.81039 XP_007986903.1.81039 XP_007986904.1.81039 XP_011745159.1.29376 XP_011745160.1.29376 XP_011745161.1.29376 XP_011745163.1.29376 XP_011895026.1.92194 XP_011895027.1.92194 XP_011895033.1.92194 XP_011895036.1.92194 XP_014973775.1.72884 XP_014973782.1.72884 XP_014973790.1.72884 ENSMMUP00000027949 9544.ENSMMUP00000027949 ENSPANP00000001757 ENSMMUP00000027949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]