SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027951 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027951
Domain Number 1 Region: 299-476,545-712
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.73e-46
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Domain Number 2 Region: 54-209,241-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.41e-38
Family WD40-repeat 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027951
Domain Number - Region: 972-1060,1211-1236
Classification Level Classification E-value
Superfamily TPR-like 0.0331
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027951   Gene: ENSMMUG00000021228   Transcript: ENSMMUT00000029868
Sequence length 1512
Comment pep:known chromosome:MMUL_1:6:151256234:151306307:-1 gene:ENSMMUG00000021228 transcript:ENSMMUT00000029868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQEPRTLPPSPNWYCARCSDAVPGGLFGFAARTSVFLVRVGPGAGESPGTPPFRVIGEL
VGHTERVSGFTFSHHPGQYNLCATSSDDGTVKIWDVETKTVVTEHALHQHTISTLHWSPR
VKDLIVSGDEKGVVFCYWLNRNDSQHLFIEPRTIFCLTCSPHHEDLVAIGYKDGIVVIID
ISKKGEVIHRLRGHDDEIHSIAWCPLPGEDCLSINQEETSEEAEITNGNAVAQAPVTKGC
YLATGSKDQTIRIWNCSRGRGVMILKLPFLKRRGGGIDPTVKERLWLTLHWPSNQPTQLV
SSCFGGELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQLLLSTSMDRD
VKCWDMATLECCWTLPSLGGFAYSLAFSSVDVGSLAIGVGDGMIRVWNTLSIKNNYDVKH
FWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGP
PVPPMSLVHTGEGDRPSLALYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSIKYKLPV
HTEISWKADGKIMALGNEDGSIEIFQVPNLKLICTIQQHHKLVNTISWHHEHGSQPELSY
LMASGSNNAVIYVHNLKTVIESSPESPVTITEPYRTLSGHTAKITSVAWSPHHDGRLVSA
SYDGTAQVWDALREEPLCNFRGHRGRLLCVTWSPLDPDCIYSGADDFCVHKWLTSMQDHS
RPPQGKKSIELEKKRLSQPKPKPKKKKKPTLRTPVKLESIDGNEEESMKENLGPVENGVS
DQEGEEEAREPELPCGLAPAEPVIREPVICTPVSSGFEKSKVTINNKVILLKKEPPKEKP
EALIKKRKARSLLPLSTSLDHRSKEELHQDCLVLATAKHSKEPNEDVSADLEERFHLGLF
TDRATLYRMIDIEGKGHLENGHPELFHQLMLWKGDLKGVLQTAAERGELTDNLVAMAPAA
GYHVWLWAVEAFAKQLCFQDQYVKAASHLLSIHKVYEAVELLKSNHFYREAIAIAKARLR
PEDPVLKDLYLSWGTVLERDGHYAVAAKCYLGATCAYDAAKVLAKKGDAASLRTAAELAA
IIGEDELSASLALRCAQELLLANNWVGAQEALQLHESLQGQRLVFCLLELLSRHLEEKRF
SEGKSSSSYHTWTTGTEGPFVERVTAVWKSIFSVDTPEQYQEAFQKLQNIKYPSATNNTP
AKQLLLHICHDLTLAVLSQQMASWDEAVQALLQAVVRSYDSGSFTIMQEVYSAFLPDGCD
HLRDKLGDRQSPAMPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVGTGHRTLCVEPSQ
QLDTASTEETDPETSQPEPNRPSELDLRLTEEGERILSTFKELFSEKHASLQNSQRTVAE
VQETLAEMIRQHQRSQLCKSTANGPDKNELEVEAEQPLSSSQSQCKEEKNEPLSLPELTK
RLTEANERMAKFPESIKAWPFPDVLECCLVLLLIRSHFPGCLAQEMQQQALELLQKYGNT
KTYKRHCQTFCT
Download sequence
Identical sequences ENSMMUP00000027951 9544.ENSMMUP00000027951 ENSMMUP00000027951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]