SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027969 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027969
Domain Number 1 Region: 579-784
Classification Level Classification E-value
Superfamily Fibronectin type III 2.08e-33
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 2 Region: 787-972
Classification Level Classification E-value
Superfamily Fibronectin type III 4.5e-29
Family Fibronectin type III 0.00000185
Further Details:      
 
Domain Number 3 Region: 294-386
Classification Level Classification E-value
Superfamily Immunoglobulin 6.92e-21
Family I set domains 0.00044
Further Details:      
 
Domain Number 4 Region: 392-483
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-19
Family I set domains 0.028
Further Details:      
 
Domain Number 5 Region: 208-294
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-18
Family I set domains 0.003
Further Details:      
 
Domain Number 6 Region: 481-584
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-18
Family I set domains 0.069
Further Details:      
 
Domain Number 7 Region: 5-98
Classification Level Classification E-value
Superfamily Immunoglobulin 4.35e-16
Family I set domains 0.00025
Further Details:      
 
Domain Number 8 Region: 106-189
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000169
Family I set domains 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027969   Gene: ENSMMUG00000021241   Transcript: ENSMMUT00000029887
Sequence length 1010
Comment pep:known chromosome:MMUL_1:2:61707935:61936903:1 gene:ENSMMUG00000021241 transcript:ENSMMUT00000029887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GELLLQGPVFVKEPSNSIFPVGSEDEKITLNCEARGNPSPHYRWQLNGSDIDTTMEHRYK
LNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAYLENFKTKMRSTVSVREGQ
GVVLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGHLYISKVEPSDVGNYTCVV
TSLVTNARVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAAKGSTVKLECFALGNPIPQ
INWRRSDGLPFSSKIKLRKFNGVLEIPNFQQEDAGSYECIAENSRGKNVARGRLTYYAKP
HWVQLIKDVETAVEDSLYWECRASGKPKPSYRWLKNGAALVLEERIQIENGALTITNLSV
TDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQVQVGSLVSLDCKPRASPR
ARSSWKKGDVSVQEHARISLLKDGGLKIANVTKADAGTYTCMAENQFGKANGTTHLVVTE
PTRITLAPSNMDVSVGESVILPCQVQHDPLLDIIFTWYFNGALADFKKDGSHFEKVGGSS
SGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAADLIVRGSPGPPENVKVDEITDTTAQLSW
KEGKDNHSPVISYSIQARTPFSVGWQTVTTVPEVIDGKTHTATVVELNPWVEYEFRVVAS
NKIGGGEPSLPSEKVRTEEAVPEVPPSEVNGGGGSRSELVITWDPVPEELQNGEGFGYVV
AFRPLGVTTWIQTVVTSPDTPRYVFRNESIVPYSPYEVKVGVYNNKGEGPFSPVTTVFSA
EEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEVRYWNGGGKEESSSKVKVA
GNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSATVNATTKKTPPSQPPGNVVWNATDTK
VLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELLLPIKEDYIIEVKATT
DGGDGTSSEQIRIPRITSMDARGSTSAISNVHPMSSYLPIVLFFIVYALW
Download sequence
Identical sequences 9544.ENSMMUP00000027969 ENSMMUP00000027969 ENSMMUP00000027969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]