SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028019 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028019
Domain Number 1 Region: 269-391
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.05e-24
Family PWWP domain 0.008
Further Details:      
 
Domain Number 2 Region: 134-262
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000000000523
Family Bromodomain 0.0027
Further Details:      
 
Domain Number 3 Region: 86-151
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000013
Family PHD domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028019
Domain Number - Region: 459-527
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0224
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028019   Gene: ENSMMUG00000021279   Transcript: ENSMMUT00000029940
Sequence length 567
Comment pep:known chromosome:MMUL_1:9:95100:210289:1 gene:ENSMMUG00000021279 transcript:ENSMMUT00000029940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAV
KDGLIVETLTVGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFR
VYHSKCLSDEFRLRDSSSPWQCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKG
KDSKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGDSEQADIA
RMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQK
EDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGR
FWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSSS
QEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTSDGVCQSMCHDKYTKIFNDFKDR
MKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVE
EIKKLATQHKQLISQTKKKQWVNTSLF
Download sequence
Identical sequences ENSMMUP00000028018 XP_005564531.1.63531 XP_008000272.1.81039 XP_011755056.1.29376 XP_011755057.1.29376 XP_011797670.1.43180 XP_011846937.1.47321 XP_015001807.1.72884 9544.ENSMMUP00000028018 ENSMMUP00000028019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]