SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028088 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028088
Domain Number 1 Region: 508-574,614-712
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-31
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 2 Region: 720-845
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-19
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 
Domain Number 3 Region: 1132-1264
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-19
Family Second domain of FERM 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028088
Domain Number - Region: 76-167,619-639
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000418
Family BAR domain 0.05
Further Details:      
 
Domain Number - Region: 1033-1110
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000448
Family Ubiquitin-related 0.055
Further Details:      
 
Domain Number - Region: 1268-1327
Classification Level Classification E-value
Superfamily PH domain-like 0.00615
Family Third domain of FERM 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028088   Gene: ENSMMUG00000021326   Transcript: ENSMMUT00000030013
Sequence length 1403
Comment pep:known chromosome:MMUL_1:7:130647363:130700690:1 gene:ENSMMUG00000021326 transcript:ENSMMUT00000030013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATQGRRRRRPEGARVPGARRGRPRARWRAPRNNPEVDSIMAELKVDARASVDWQKRCLTL
ETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAETQVGVMEEKVKLSNLKNVDS
AGSLHRKYQELLKAIKGKDELISQLEAQLEKQKQMRAEEAKTVQEKAAKIKEWVTLKLAE
LEMENQHLKSHNQHLVEQVGALQDALEAIQIAPSRKLLVPPHGAAEQDSVPSEPGIQPTG
QNSGSQAEGLKAAVLAPSPGALQSKDSVSEAASPSEDSSSSTVHSGEMVEAKPLQPHLGR
EGPPHQPCMKLRTFRCGSASWGEGLVTAQRGMLPGTKTSAREGGPGSSLTLPKVRAPGTP
RDSIQLTKRHHSQPQVGHGHFDRVVSIEIGAFSALHPSGLPELESRARYREEPEKMEMEE
PPPAGKNEERESPQALGAELEEVELGNKPPTPPLHQFSSWESRIYAVATSGMRLSDVSPR
SNTACCASSPPALASPGSFSGLVYKNVTVPVYTALKGRATQISNMPFMDESSGSDDDCSS
QASFRMSVPCSESRKTSGLGSPRAIKRGTEKGSRGRVQQQGVPQSSLNRSRVWYSENTLS
RYSIIFSEAAGPLGPESLEKSGYLLKMGSRVKTWKRRWFVLRQGQIMYYKSPSDVIRKPQ
GQVDLNSRCQIVRGEGSQTFQLISEKKTYYLTADSPSLLEEWIRVLQNLLKVQATGPPAL
PRGGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRSHEDKRPLGCLPVRDAHIEEVDR
SCDSDEDYEAGGTRRLLSSHCTLVIHPAEHSPTYLLIGTKHEKDTWLYHLTVAAGGSSAK
VGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYASLTTLPSEALQTEALKLFKSCQ
LFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMKQTSCRPPQKYSLMQVVQL
SCLCTDSCRPSTHPMLHTAPKLSTNAILLSETGQYATYCQRAVERTLQTGEREARPSRME
VVSILLRNPFHHSLPFSIPVHFTNGTYQVVGFDGSSTVDEFLQRLNQEIGMRKPSHSGFA
LFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKELHPRKSEGGTRVVKLMYKNRLYFRSQ
VKGETDRERLLLASQTSREIVAGRFPVNKELALEMAALMAQVEYGDLEKPALPGPGGTSP
AKAQHLLQQVLDRFYPRRYRHGAPPEQLRHLADMLTTKWATLQGCSPPECIRIYLTVARK
WPFFGAKLFAAQPAQLSSKENALVWIAVNEDGVSILDHNTMQVHVTYPYSSVTTFGGCRD
DFMLVIRSIPDKTSGKSHIEKLIFQMAAPKIAEATFIMASYMNHCSTTVNPPTNLPGACQ
LWELDGQQFFSSVSCATKGPTLL
Download sequence
Identical sequences 9544.ENSMMUP00000028088 ENSMMUP00000028088 ENSMMUP00000028088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]