SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028098 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028098
Domain Number 1 Region: 292-621
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.28e-75
Family Pancreatic carboxypeptidases 0.00000185
Further Details:      
 
Domain Number 2 Region: 113-275
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.17e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00059
Further Details:      
 
Domain Number 3 Region: 622-719
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.73e-17
Family Carboxypeptidase regulatory domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028098   Gene: ENSMMUG00000021332   Transcript: ENSMMUT00000030023
Sequence length 732
Comment pep:known chromosome:MMUL_1:10:36103201:36109751:-1 gene:ENSMMUG00000021332 transcript:ENSMMUT00000030023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLLLALAAFAPAVGPALGAPRNSVLDLAQPATTKVPGSIPARNSSLAQLPAETANGTS
EQHVRIRIIKKKKVIMKKRKKLTRPTPLVTARPLVTPTPAGTLNPAEKQETGCPPLGLES
LRVSDSRLEASSSQSFGLGPHRGRLNIQSGLEDGDLYDGAWCAEEQDTDPWFQVDAGHPT
RFSGVITQGRNSVWRYDWVTSYKVQFSNDSRTWWGSRNHSSGMDAVFPANSDPETPVLNL
LPEPQVARFIRLLPQTWLQGGTPCLRAEILACPVSDPNDLFLEASAPGSSDPLDFRHHNY
KAMRKLMKQVHEQCPNITRIYSIGKSYQGLKLYVMEMSDQPGEHELGEPEVRYVAGMHGN
EALGRELLLFLMQFLCHEFLRGNPRVTRLLTEMRIHLLPSMNPDGYEIAYHRGSELVGWA
EGRWNNQSIDLNHNFADLNTPLWEAQDDGKVPHIVPNHHLPLPTYYTLPNATVAPETRAV
IKWMKRIPFVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDDAVFRWLSTVYAGSNLA
MQDTSRRPCHSQDFSVHGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHENE
LPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDYWR
LLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPPDL
RRRLERLRGQKD
Download sequence
Identical sequences G7N2T2
9544.ENSMMUP00000028098 NP_001253858.1.72884 ENSMMUP00000028098 ENSMMUP00000028098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]