SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028186 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028186
Domain Number 1 Region: 10-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-90
Family Protein kinases, catalytic subunit 0.00000189
Further Details:      
 
Domain Number 2 Region: 424-548
Classification Level Classification E-value
Superfamily NTF2-like 2.04e-44
Family Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A 0.00000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028186   Gene: ENSMMUG00000021393   Transcript: ENSMMUT00000030118
Sequence length 556
Comment pep:known chromosome:MMUL_1:9:63144114:63206969:1 gene:ENSMMUG00000021393 transcript:ENSMMUT00000030118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKNSLVSPAQEPAPLQTAMEPQTTVV
HNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSLVPEGRSSRDRTAPSAGMQPQPSLCS
SAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENL
LSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKW
LNVHYHCSGASAAPLQ
Download sequence
Identical sequences A0A2K5UV98 A0A2K6DKJ5 H9G0A4
9544.ENSMMUP00000028184 NP_001253098.1.72884 XP_005565524.1.63531 XP_011713050.1.29376 ENSMMUP00000028184 ENSMMUP00000028186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]