SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028263 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028263
Domain Number 1 Region: 89-228
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 1.42e-38
Family Ribosomal protein L30p/L7e 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028263
Domain Number - Region: 31-76
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0837
Family FCH domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028263   Gene: ENSMMUG00000021456   Transcript: ENSMMUT00000030202
Sequence length 235
Comment pep:known chromosome:MMUL_1:19:6506129:6506876:1 gene:ENSMMUG00000021456 transcript:ENSMMUT00000030202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTMEGVEEKKKVPAVSETLKNKRRNFAQLKIKHLRKKFAQKMLQKARRKLIYEKKHYHKE
YRQMYRTEIRMERMSRKADNVYVPAEPTLTFVIRTRGTDGVSPKVRKVLQLLHLRQIFNG
NFVKLNEANQRAEDCRAIRCMGYPNLKSVNKLIYKRGYGKISKKSLGKYGIICMKHVIHE
VYTVGKRFKEAHNFLWPFKLSSPQGGMKKKITHFVEGGDAGNREEQINTTGFLEE
Download sequence
Identical sequences 9544.ENSMMUP00000028263 ENSMMUP00000028263 ENSMMUP00000028263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]