SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028331 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028331
Domain Number 1 Region: 134-274
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000421
Family NTF2-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028331   Gene: ENSMMUG00000021507   Transcript: ENSMMUT00000030275
Sequence length 329
Comment pep:known chromosome:MMUL_1:2:12384400:12394258:1 gene:ENSMMUG00000021507 transcript:ENSMMUT00000030275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEMSGLSFSEMEGCRNLLGLLDNDEIMALCDTVTNRLVQPEDRQDAVRAILVYSQSAEEL
LRRRKVHREVIFKYLATQGIIIPPATEKHNLIQHAKDYWQKQSQLKLKETPEPVTKTENI
QLFQQQVKEDKKAEKVDFRRLGEEFCHWFFGLLNSQNPFLGPPQHEWGPQHFWHDVKLRF
YYNTSEQNVTDYYGAEIVSLRLLSLVKEEFLFLSPNLDSHGLKCASSPHGLVMVGVAGTV
HRGNTCLGIFEQIFGLIRCPFVENTWKIKFINLKIRGESSLAPGTLPKPAVKFEQSDLEA
FYNVITLCGTSEVRHNVKQFLDSGTGDQV
Download sequence
Identical sequences A0A2K5VUA8 A0A2K6E1E3 G7MJU1
9544.ENSMMUP00000028331 ENSMMUP00000028331 ENSMMUP00000028331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]