SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028338 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028338
Domain Number 1 Region: 236-543
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.63e-75
Family Epoxide hydrolase 0.000000000193
Further Details:      
 
Domain Number 2 Region: 1-213
Classification Level Classification E-value
Superfamily HAD-like 6e-37
Family YihX-like 0.00000000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028338   Gene: ENSMMUG00000021515   Transcript: ENSMMUT00000030283
Sequence length 555
Comment pep:known chromosome:MMUL_1:8:27641748:27698803:1 gene:ENSMMUG00000021515 transcript:ENSMMUT00000030283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFHKGGPEGATTRLMRGEITL
SQWIPLMEENCRKCSQTSEVSLPKNFSVNEIFGKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKTHFDFLIESCQVGMVKPEPQIYRFLLDTLKASPSEV
VFLDDVGSNLKPARDLGMVTILVQDTDTALRELEKVTGIQLLNTPAPLPTCCNPSDVSHG
YVTIKPGVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVIAMDMKGYGESS
APPEIEEYCMEVLCKSQYVCSIDCGLSQAVFIGHDWGGVLVWYMALFYPERVRAVASLNT
PFIPANPNVPPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEMGGLFVRTPEEPSLSRMVSEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSKHMEDWIPHLKRGHIEDCGHWTQMDKPAEVNQILIK
WLESDARNPPVVSKM
Download sequence
Identical sequences ENSMMUP00000028338 9544.ENSMMUP00000028338 ENSMMUP00000028338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]