SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028349 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028349
Domain Number 1 Region: 5-51
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000185
Family Ribosomal protein L24e 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028349   Gene: ENSMMUG00000021527   Transcript: ENSMMUT00000030296
Sequence length 146
Comment pep:known chromosome:MMUL_1:2:165433484:165433924:1 gene:ENSMMUG00000021527 transcript:ENSMMUT00000030296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKVKPCSFSGYKIHPGHGRDYTRMDKKVFQFLNAFIFKRNPQQINWTILYRKKRKKGQSE
EIQKKRTHPAVKFQIAITGASLADIMAKRNQKPEVRMAQREQTTRAAKEAQKAKQASKKT
AMTAAKAPTKAAPEQKIVKPVTISAP
Download sequence
Identical sequences F7FF84
ENSMMUP00000028349 9544.ENSMMUP00000028349 ENSMMUP00000028349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]