SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028374 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028374
Domain Number 1 Region: 343-600
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.74e-70
Family Protein kinases, catalytic subunit 0.000000000297
Further Details:      
 
Domain Number 2 Region: 143-255
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-30
Family SH2 domain 0.000000445
Further Details:      
 
Domain Number 3 Region: 7-132
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-29
Family SH2 domain 0.000000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028374   Gene: ENSMMUG00000021545   Transcript: ENSMMUT00000030321
Sequence length 621
Comment pep:known chromosome:MMUL_1:13:97527772:97554402:1 gene:ENSMMUG00000021545 transcript:ENSMMUT00000030321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPAAHLPFFYGSISRSEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
TQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASSASGAAAPTLPAHPSTFTHPQRRIDTLNSDGYTPEPARVT
SPEKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGSG
PLHKFLAGKKEEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KAGEGRGPEVMAFIEQGKRMECPSECPPELYELMSDCWIYKWEDRPDFLTVEQRMRACYY
SLASKAEGSPGCAQKAEAACA
Download sequence
Identical sequences 9544.ENSMMUP00000028374 ENSMMUP00000028374 ENSMMUP00000028374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]