SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028386 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028386
Domain Number 1 Region: 66-131
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000018
Family Ovomucoid domain III-like 0.0011
Further Details:      
 
Domain Number 2 Region: 162-207
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000499
Family Ovomucoid domain III-like 0.0062
Further Details:      
 
Domain Number 3 Region: 2-37
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000549
Family TB module/8-cys domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028386   Gene: ENSMMUG00000021556   Transcript: ENSMMUT00000030333
Sequence length 227
Comment pep:known chromosome:MMUL_1:19:423632:430179:1 gene:ENSMMUG00000021556 transcript:ENSMMUT00000030333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCWLQQGQEATCSLVLRTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCK
DSCDGVECGPGKACRMLGGRPRCECAPDCSGLPARLQVCGSDGATYRDECELRAARCRGH
PDLRVMYRGRCRKSCERVVCPRPQSCVVDQTGSAHCVVCRAAPCPVPSSPGQELCGNNNV
TYISSCHLRQATCFLGRSIGVRHAGSCAGTPEEPPDGESEEEEENFV
Download sequence
Identical sequences 9544.ENSMMUP00000028386 ENSMMUP00000028386 ENSMMUP00000028386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]