SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028413 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028413
Domain Number 1 Region: 681-865
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-25
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 260-353
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-22
Family I set domains 0.0094
Further Details:      
 
Domain Number 3 Region: 340-442
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-22
Family I set domains 0.038
Further Details:      
 
Domain Number 4 Region: 450-536
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-22
Family I set domains 0.0062
Further Details:      
 
Domain Number 5 Region: 551-655
Classification Level Classification E-value
Superfamily Fibronectin type III 5.87e-22
Family Fibronectin type III 0.0000219
Further Details:      
 
Domain Number 6 Region: 168-262
Classification Level Classification E-value
Superfamily Immunoglobulin 5.22e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 64-162
Classification Level Classification E-value
Superfamily Immunoglobulin 4.74e-17
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028413   Gene: ENSMMUG00000021576   Transcript: ENSMMUT00000030363
Sequence length 1370
Comment pep:known chromosome:MMUL_1:14:123011270:123026851:1 gene:ENSMMUG00000021576 transcript:ENSMMUT00000030363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRYLLKTLLQMNLFADSLAGDISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSTVGPE
DAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRAHRLLLPS
GALFFPRIVHGRRARPDEGVYTCVARNYLGAAASRNASLEVAVLREDFRQSPGNVVVAVG
EPTVLECAPPRGHPEPSVSWRKDGARLKEEEGRITIRRGKLMMSHTLKSDAGMYVCVASN
MAGERESAAAEVVVLERPSFLRRPVNQVVLADAPVNFLCEVKGDPPPRLHWRKEDGELPI
GRYEIRSDHSLWIGPVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQPQDQMAAP
GESVAFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAG
YYVCQAVSVAGSILAKALLQIKGASLDGLPPVILQGPANQTLVLGSSVWLPCRVTGNPQP
SVRWKKDGQWLQGDDLQFKPMANGTLYIANVQEMDMGFYSCVAKSSVGEATWSGWLKMRE
DWGVSPDPPTEPSTPPGPPSQPVVTEITKNSITLTWEPNPQTGAAVTSYVIEAFSPAAGN
TWRTVADGVQLETHTVSGLQPNTIYVFLVRAVGTWGLSDPSPVSEPVRTQDSSPSRPVED
PWRGQQGLAEVAVRLQEPIVLGPRTLQVSWIVDGPVQLVQGFRVSWRVAGPDRGSWTMLD
LQSPSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEEAPSGPPQGVAVALG
GDGNSSITVTWEPPLPSQQNGVITEYQIWCLGNESRFHLNRSAAGGARSAMLRGLVPGLL
YRTLVAAATSAGVGVASAPVLVQLPSPPDLEPGLEVGAGLAEQLARVLRKPAFLAGSGAA
CGALLLGLCAALYRRRKQRKELSHYTASFAYTPAVSFPHSEGLSGASSRPPMGLGPAPYP
WLADSWPHPSRSPSAQEPRGSCCPSNPDPDDRYYNEAGISLYLAQTARGTAAPGEGPVYS
TIDPAGEELQTFHGGFPQHPSGDAGPWSQYAPPEWSQGDSGMTPTPETPSPQPLLPPHLL
TLPSPQLTCPISTRCPGREGWMDGWMDGWMDGWIWGTEVSGLCQGGSVIWTGIGRLTRSL
MPIRLALAGVAHSRHSGFVEGTDAEASCHCRRVPLGPSSPLSVSQPMLGIREGRPAGSAA
LPHLSPSPAPSIASSAPGRTWQGNGEMTPPLQGPRARFRKKPKALPYRRENSPGDLPPPP
LPPPEEEASWALELRAAGSMSSLERERSGERKVVQAMPLAAQRGPHPDEEAWLPYSRPSF
LSRGQGTSTCSTAGSNSSRGSSSSRGSRGPGRSRSRSRSQSQRPGQKRRE
Download sequence
Identical sequences 9544.ENSMMUP00000028413 ENSMMUP00000028413 ENSMMUP00000028413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]