SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028414 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028414
Domain Number 1 Region: 254-428
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-20
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 2 Region: 31-136
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-16
Family I set domains 0.0076
Further Details:      
 
Domain Number 3 Region: 179-224,250-262
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000295
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028414   Gene: ENSMMUG00000021578   Transcript: ENSMMUT00000030364
Sequence length 994
Comment pep:known chromosome:MMUL_1:14:123031232:123044537:-1 gene:ENSMMUG00000021578 transcript:ENSMMUT00000030364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGGESLRGSRASRPLLLLLIMGGMAQDSPPQILVHPQDQLFQGPGPARMSCRASGQPP
PTIRWLLNGQPLSMVPPDPHHLLPDGTLLLLQPPARGHAHDGQALSTDLGVYTCEASNRL
GTAVSRGARLSTWAHPEGLTCPPAPASSSRILRRGEQGGPQISPQLRAPPHVGDFTVSGG
SLLMARAEKSDAGAYMCVAANSAGHRESRAARVSIQEPQDYTEPVELLAVRIQLENVTLL
NPDPAKGPKPGPAVWLSWKVSGPAAPAQSYTALFRTQTAPGDQGAPWAEELLAGWQSAEL
GGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEKVPSAPPQEVTLKPGNGSVLVSWVPP
PAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATRMPGSYCVQVAAVTGAGAGE
PSSPVCLLLEQAMERATREPSEHGPWTLEQLRATLKRPEVIATCGVVLWLLLLGTAVCIH
RRRRAGVHLGPGLYRYTSKDAILKHRMDHSDSQWLADTWRSTSGSRDLSSSSSLSSRLGA
DPRDPLDCRRSLLSWDSRSPGVPLLPDTSTFYGSLIAELPSSPLARPSPQVPAVRRLPPQ
LARLSSPCSSSDSLCSHRGLSSPRLSLAPTEAWKAKKKQELQHVNSSPLLRGSQPLELRA
CELGNRGSKNLSQSPGAVPQALVAWRALGPKLLSSSNELVTRPLPPAPLFPHETPQTQSQ
QTQRVWGPEAGLGERGSVLTTVPSLSHPDQASEGRIKLEREAERREVMVSSLGEDQDSVL
TPEEVALCLELSEGEETPRNSVSPMPRAPSPPTTYGYISTPTASEFTGMDRTGGGVGSEG
GVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSFLADAHFARALAVA
VDSFGFGLEPREADCVFTDASSPPSPRDDIFLTPNLSLPLWEWRPDWLEDMEVNHTQLLG
RGMPPWSPDSRISSQRSQLHCPVPKAGASPVDYS
Download sequence
Identical sequences ENSMMUP00000028414 9544.ENSMMUP00000028414 ENSMMUP00000028414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]