SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028526 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028526
Domain Number 1 Region: 64-162
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 1.31e-17
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.003
Further Details:      
 
Domain Number 2 Region: 164-218
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.00000000000536
Family Head domain of nucleotide exchange factor GrpE 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028526   Gene: ENSMMUG00000021662   Transcript: ENSMMUT00000030484
Sequence length 225
Comment pep:known chromosome:MMUL_1:6:145817981:145823706:1 gene:ENSMMUG00000021662 transcript:ENSMMUT00000030484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRSLWAGRLRVQRLLASTAAWDSKGWPLPFSTATQRTAGEDCRSEDPPDELGPSLTER
ALRVKAIKLEKEVQDLTLRYQRAVADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADIL
EKTTECISEESEPENQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHEL
ICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL
Download sequence
Identical sequences F7F5I2
9544.ENSMMUP00000028526 NP_001248082.1.72884 ENSMMUP00000028526 ENSMMUP00000028526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]