SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028570 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028570
Domain Number 1 Region: 91-174
Classification Level Classification E-value
Superfamily E set domains 3.45e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028570
Domain Number - Region: 181-232
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00126
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028570   Gene: ENSMMUG00000021696   Transcript: ENSMMUT00000030529
Sequence length 420
Comment pep:known chromosome:MMUL_1:6:155115309:155257318:-1 gene:ENSMMUG00000021696 transcript:ENSMMUT00000030529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRNANHDDLFLHRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNM
FVHNNSKHGRRARRLDPSEGTPSYLEHAATPCIKAISPSEGWTTGGATVIIIGDNFFDGL
QVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPT
IDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEAL
YSVPRNHNQLPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYV
PSTTPQQTNYNSVTTSMNGYGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLP
SNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQDMENKIVAKS
Download sequence
Identical sequences G7P6R8
ENSMMUP00000028570 ENSMMUP00000028570 9544.ENSMMUP00000028570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]