SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028574 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028574
Domain Number 1 Region: 110-233
Classification Level Classification E-value
Superfamily Fibronectin type III 6.43e-49
Family Fibronectin type III 0.000000246
Further Details:      
 
Domain Number 2 Region: 234-325
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000105
Family Fibronectin type III 0.0000024
Further Details:      
 
Domain Number 3 Region: 31-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000171
Family I set domains 0.0000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028574   Gene: ENSMMUG00000021701   Transcript: ENSMMUT00000030533
Sequence length 328
Comment pep:known chromosome:MMUL_1:6:155730124:155740835:-1 gene:ENSMMUG00000021701 transcript:ENSMMUT00000030533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHQQLVISWFSLVFLASPLMAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERV
RGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVIC
RKNASFSVQAQDRYYSSSWSEWASVPCS
Download sequence
Identical sequences A0A2K6C7V0 G7P6S2 P48095
ENSMMUP00000028574 ENSMMUP00000028574 9544.ENSMMUP00000028574 NP_001038190.1.72884 NP_001274204.1.63531 XP_011740675.1.29376 XP_011740676.1.29376 XP_011740677.1.29376 XP_014996758.1.72884 XP_015306901.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]