SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028608 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028608
Domain Number 1 Region: 766-974
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.25e-24
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028608   Gene: ENSMMUG00000021723   Transcript: ENSMMUT00000030568
Sequence length 985
Comment pep:known chromosome:MMUL_1:14:185347:194544:1 gene:ENSMMUG00000021723 transcript:ENSMMUT00000030568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGEKLTSVTDGRGVHAAPSTQRAEDSSESREEEQAPEGQDLDMLFPAGAGKLPLNFTHQT
PPWREEYKGQVKLHVFEDWCGGALNWFRVDGAWRIHQVQLPGVQAQAVSDCGVHVHALVY
SWEGATWCFLTRCTIAHTLHKHPPSPAAILLRALRGVGTTCPLPWLHYAWRGPTLAPRVP
RLMASRRYYFELLHKQDDRGSDHVEVGWRAFLPGLKFEVISSAHISLYTDESALKMDHVA
HVPQSPASHVGGRLPQEDTSADMLRPDPRDTFFLTPRMESSSLENVLEPCAYAPTYVVKD
FPIARYQGLQFVYLSFVYPNDYTRLTHMETDNKCFYRESPLYLERFGFYKYMKMDKEEGD
EDEEEEVQRRAFLFLNPDDFLDDEDEGELLDSLEPTEAAPSRSGPQSSAPAVHAEPGATP
APPTPPRPRDEGTPRHSRALSWASRAARPLPLFLGRAPPPRPAAEQQPPKVYVTRVRPGQ
RASPRAPAPRAPWPPFPGVFLHPRPLPRVQLRAPPRPPRPHGRRTGGPQATQPRPPARAQ
ATQGGQEGQARTLGPAVPTVDSNLSSEARPVTSFLSLSQVSGPQLPGEGEEEEEGEDDGA
PGDEAASEDSEEAAGPALGRWREDAIDWQRTFSVGAVDFELLRSDWNDLRCNVSGNLQLP
EAEAVDVAAQYMERLNARHGGYGAGSTRARAVVGPGTAGERRDLPGAPPRAGASSLHLRT
PLLLRHLGQSSGPLDPSSSPLAAEAGSEDGGRAGTVSPLVMPWRPHGMVIVVVPPLPTWA
RWVAQFLADMAVLHARTGDSRFSVVLVDFESEDMDVERALRTARLPRYQYLRRTGNFERS
AGLQAGVDAVEDASSIVFLCDLHIHFPPNILDGIRKHCVEGRLAFAPVVMRLSCGSSPRD
PHGYWEVNGFGLFGIYKSDFDRVGGMNTEEFRDQWGGEDWELLDRVLQAGLEVERLRLRN
FYHHYHSKRGMWSVRSRKGSHTGAS
Download sequence
Identical sequences ENSMMUP00000028608 9544.ENSMMUP00000028608 ENSMMUP00000028608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]