SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028621 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028621
Domain Number 1 Region: 20-73,196-334,362-408
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.58e-69
Family Inositol polyphosphate kinase (IPK) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028621   Gene: ENSMMUG00000021732   Transcript: ENSMMUT00000030581
Sequence length 410
Comment pep:known chromosome:MMUL_1:4:33433880:33445781:-1 gene:ENSMMUG00000021732 transcript:ENSMMUT00000030581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVMGPASLTGTLRWEAASQRTSS
NAPRYDCTITVHLWKDSTGHLSLVANPVKESREPFKVSTESAAMAIWQTLQQTTGSSGSA
CALAQWPHAQLARSPKESPAKALLRSDTHLNAPASSLVEDTNGNQVERKSFNPWGLHCHQ
AHLTRLCSEYPENKRHRFLLLENVVSQYTHPCVLDLKMGTRQHGDDASEEKKARHMRKCA
QSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGFRQALYQFLHNGSHLRRELLE
PILQQLRALLSVIRSQSSYRFYSSSLLIIYDGQEPPERAPGSPHPQEAPQAAHGSSPSGL
TKVDVRMIDFAHTTYKGSWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE
Download sequence
Identical sequences 9544.ENSMMUP00000028621 ENSMMUP00000028621 ENSMMUP00000028621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]