SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028692 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028692
Domain Number 1 Region: 405-598
Classification Level Classification E-value
Superfamily Fibronectin type III 1.2e-40
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 2 Region: 725-921
Classification Level Classification E-value
Superfamily Fibronectin type III 2.41e-39
Family Fibronectin type III 0.00052
Further Details:      
 
Domain Number 3 Region: 305-400
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-21
Family I set domains 0.0026
Further Details:      
 
Domain Number 4 Region: 122-208
Classification Level Classification E-value
Superfamily Immunoglobulin 4.07e-21
Family I set domains 0.042
Further Details:      
 
Domain Number 5 Region: 222-317
Classification Level Classification E-value
Superfamily Immunoglobulin 6.35e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 606-704
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000354
Family Fibronectin type III 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028692
Domain Number - Region: 24-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000211
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028692   Gene: ENSMMUG00000021788   Transcript: ENSMMUT00000030657
Sequence length 1124
Comment pep:known chromosome:MMUL_1:7:43871165:43899614:-1 gene:ENSMMUG00000021788 transcript:ENSMMUT00000030657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGLLLPQETTVELRCGVGPLQVILGPEQAAVLNCSLGAAATGPPTRVTWSKDGDTLLEHD
HLHLLPNGSLWLSQPLAPNGSDEPVPEAVGVIEGSYSCLAHGPLGVLASQAAVVKLATLA
DFSLHPESQTVEENGTARFECHIEGLPAPIISWEKDQVTLPEEPRLITLPNGVLQILDVQ
ENDAGPYRCVATNSASQRFSQEALLSVAHRGSLASTRGQDVVIVAAPENTTVVSGQSVVM
ECVASADPTPFVSWVRQDGKPISTDVIVLGRTNLLIASAQPRHSGVYVCRANKPRTRDFA
TAAAELRVLAAPAITQAPEALSRTRASTARFVCRASGEPQPALRWLHNGAPLRPNGRVKV
QGGGGSLVITQIGLQDAGYYQCVAENIAGMACAAASLAVVVREGLPSAPTRVTATPLSSS
AVLVAWERPELHSEQIIGFSLHYQKARGMDNVEYQFAVNNDTTELQVRDLEPNTDYEFYV
VAYSQLGASRTSTPALVHTLDDVPSAAPQLSLSSPNPSDIRVAWLPLPPSLSNGQVVKYK
IEYGLGKEDQIFSTEVRGNETQLTLNSLQPNKVYRVRISAGTAAGFGAPSQWMQHRTPSM
HNQSHVPFAPAELKVQARMESLVVSWQPPPHPTQISGYKLYWREVGAEEEANGDRPPGGR
GDQAWDVGPIRLKKKVKQYELTQLVPGRLYEVKLVAFNKHEDGYAAVWKGKTEKAPAPDM
PIQRGPPLPPAHVHAESNSSTSIWLRWKKPDFTTVKIVNYTVRFSPWGLRNASLVTYYTS
SGEDILIGGLKPFTKYEFAVQSHGVDVDGPFGSVVERSTLPDRPSTPPSDLRLSPLTPST
VRLHWCPPTEPNGEIVEYLILYSNNHTQPEHQWTLLTTEGNIFSAEVHGLESDTRYFFKM
GARTEVGPGPFSRLQDVITLQEKLSDSLDMHSVTGIIVGVCLGLLCLLACMCAGLRRSPH
RESLPGLSSTATPGNPALYSRAHLGPPSPPAAHELESLVHPHPQDWSPPPSDVEDRAEVH
SLMGGGISEGRGHSKRKISWAQPSGPSWAGSWAGCELPQAGPRPALTRALLPPAGTGQTL
LLQALVYDAIKGNGRKKSPPACRNQVEAEVIVHSDFSASNGNPD
Download sequence
Identical sequences ENSMMUP00000028692 9544.ENSMMUP00000028692 ENSMMUP00000028692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]